Lineage for d2fj6a1 (2fj6 A:1-74)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2002300Superfamily a.60.15: YozE-like [140652] (1 family) (S)
  5. 2002301Family a.60.15.1: YozE-like [140653] (2 proteins)
    Pfam PF06855; DUF1250
  6. 2002302Protein Hypothetical protein YozE [140654] (1 species)
  7. 2002303Species Bacillus subtilis [TaxId:1423] [140655] (1 PDB entry)
    Uniprot O31864 1-74
  8. 2002304Domain d2fj6a1: 2fj6 A:1-74 [133547]
    Other proteins in same PDB: d2fj6a2

Details for d2fj6a1

PDB Entry: 2fj6 (more details)

PDB Description: solution nmr structure of the upf0346 protein yoze from bacillus subtilis. northeast structural genomics target sr391.
PDB Compounds: (A:) Hypothetical UPF0346 protein yozE

SCOPe Domain Sequences for d2fj6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fj6a1 a.60.15.1 (A:1-74) Hypothetical protein YozE {Bacillus subtilis [TaxId: 1423]}
mksfyhyllkyrhpkpkdsisefanqayedhsfpktstdyheissylelnadylhtmatf
deawdqyesevhgr

SCOPe Domain Coordinates for d2fj6a1:

Click to download the PDB-style file with coordinates for d2fj6a1.
(The format of our PDB-style files is described here.)

Timeline for d2fj6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fj6a2