Class a: All alpha proteins [46456] (258 folds) |
Fold a.60: SAM domain-like [47768] (15 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.15: YozE-like [140652] (1 family) |
Family a.60.15.1: YozE-like [140653] (1 protein) Pfam PF06855; DUF1250 |
Protein Hypothetical protein YozE [140654] (1 species) |
Species Bacillus subtilis [TaxId:1423] [140655] (1 PDB entry) |
Domain d2fj6a1: 2fj6 A:1-74 [133547] |
PDB Entry: 2fj6 (more details)
SCOP Domain Sequences for d2fj6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fj6a1 a.60.15.1 (A:1-74) Hypothetical protein YozE {Bacillus subtilis [TaxId: 1423]} mksfyhyllkyrhpkpkdsisefanqayedhsfpktstdyheissylelnadylhtmatf deawdqyesevhgr
Timeline for d2fj6a1: