Lineage for d2fj6a1 (2fj6 A:1-74)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 643515Superfamily a.60.15: YozE-like [140652] (1 family) (S)
  5. 643516Family a.60.15.1: YozE-like [140653] (1 protein)
    Pfam PF06855; DUF1250
  6. 643517Protein Hypothetical protein YozE [140654] (1 species)
  7. 643518Species Bacillus subtilis [TaxId:1423] [140655] (1 PDB entry)
  8. 643519Domain d2fj6a1: 2fj6 A:1-74 [133547]

Details for d2fj6a1

PDB Entry: 2fj6 (more details)

PDB Description: solution nmr structure of the upf0346 protein yoze from bacillus subtilis. northeast structural genomics target sr391.
PDB Compounds: (A:) Hypothetical UPF0346 protein yozE

SCOP Domain Sequences for d2fj6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fj6a1 a.60.15.1 (A:1-74) Hypothetical protein YozE {Bacillus subtilis [TaxId: 1423]}
mksfyhyllkyrhpkpkdsisefanqayedhsfpktstdyheissylelnadylhtmatf
deawdqyesevhgr

SCOP Domain Coordinates for d2fj6a1:

Click to download the PDB-style file with coordinates for d2fj6a1.
(The format of our PDB-style files is described here.)

Timeline for d2fj6a1: