SCOPe 2.08: Domain d2fj6a1: 2fj6 A:1-74

Lineage for d2fj6a1 (2fj6 A:1-74)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.15: YozE-like [140652] (1 family)

5. Family a.60.15.1: YozE-like [140653] (2 proteins)
   Pfam PF06855; DUF1250

6. Protein Hypothetical protein YozE [140654] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [140655] (1 PDB entry)
   Uniprot O31864 1-74

8. Domain d2fj6a1: 2fj6 A:1-74 [133547]
   Other proteins in same PDB: d2fj6a2

Details for d2fj6a1

PDB Entry: 2fj6

PDB Description: solution nmr structure of the upf0346 protein yoze from bacillus subtilis. northeast structural genomics target sr391.

PDB Compounds: (A:) Hypothetical UPF0346 protein yozE

SCOPe Domain Sequences for d2fj6a1:

Sequence; same for both SEQRES and ATOM records:

>d2fj6a1 a.60.15.1 (A:1-74) Hypothetical protein YozE {Bacillus subtilis [TaxId: 1423]}
mksfyhyllkyrhpkpkdsisefanqayedhsfpktstdyheissylelnadylhtmatf
deawdqyesevhgr

Timeline for d2fj6a1:

• d2fj6a1 first appeared in SCOP 1.73
  
• d2fj6a1 appears in SCOPe 2.07