Lineage for d2fj2d1 (2fj2 D:5-71)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2928976Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2929052Protein Macrophage inflammatory protein, MIP [54128] (5 species)
    has different dimerisation mode
  7. 2929096Species Kaposi's sarcoma-associated herpesvirus, VMIP-II [TaxId:37296] [54131] (7 PDB entries)
    anti-HIV chemokine
  8. 2929103Domain d2fj2d1: 2fj2 D:5-71 [133546]
    automatically matched to d1hhva_

Details for d2fj2d1

PDB Entry: 2fj2 (more details), 2.3 Å

PDB Description: Crystal Structure of Viral Macrophage Inflammatory Protein-II
PDB Compounds: (D:) Viral macrophage inflammatory protein-II

SCOPe Domain Sequences for d2fj2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fj2d1 d.9.1.1 (D:5-71) Macrophage inflammatory protein, MIP {Kaposi's sarcoma-associated herpesvirus, VMIP-II [TaxId: 37296]}
whrpdkcclgyqkrplpqvllsswyptsqlcskpgvifltkrgrqvcadkskdwvkklmq
qlpvtar

SCOPe Domain Coordinates for d2fj2d1:

Click to download the PDB-style file with coordinates for d2fj2d1.
(The format of our PDB-style files is described here.)

Timeline for d2fj2d1: