| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) ![]() form dimers with different dimerisation modes |
| Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
| Protein Macrophage inflammatory protein, MIP [54128] (5 species) has different dimerisation mode |
| Species Kaposi's sarcoma-associated herpesvirus, VMIP-II [TaxId:37296] [54131] (7 PDB entries) anti-HIV chemokine |
| Domain d2fj2b1: 2fj2 B:5-71 [133544] automatically matched to d1hhva_ |
PDB Entry: 2fj2 (more details), 2.3 Å
SCOPe Domain Sequences for d2fj2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fj2b1 d.9.1.1 (B:5-71) Macrophage inflammatory protein, MIP {Kaposi's sarcoma-associated herpesvirus, VMIP-II [TaxId: 37296]}
whrpdkcclgyqkrplpqvllsswyptsqlcskpgvifltkrgrqvcadkskdwvkklmq
qlpvtar
Timeline for d2fj2b1: