Lineage for d2fj1a2 (2fj1 A:68-208)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1279958Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1279959Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 1279960Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 1280146Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. 1280147Species Escherichia coli [TaxId:562] [48501] (25 PDB entries)
  8. 1280156Domain d2fj1a2: 2fj1 A:68-208 [133542]
    Other proteins in same PDB: d2fj1a1
    automated match to d1bjza2
    complexed with cl, ctc, ni

Details for d2fj1a2

PDB Entry: 2fj1 (more details), 2.2 Å

PDB Description: crystal structure analysis of tet repressor (class d) in complex with 7-chlortetracycline-nickel(ii)
PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d2fj1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fj1a2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

SCOPe Domain Coordinates for d2fj1a2:

Click to download the PDB-style file with coordinates for d2fj1a2.
(The format of our PDB-style files is described here.)

Timeline for d2fj1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fj1a1