Lineage for d2fj1a2 (2fj1 A:68-208)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) 
Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species) Species Escherichia coli [TaxId:562] [48501] (37 PDB entries) 
Domain d2fj1a2: 2fj1 A:68-208 [133542]
Other proteins in same PDB: d2fj1a1
automated match to d1bjza2
complexed with cl, ctc, ni
Details for d2fj1a2
PDB Entry: 2fj1 (more details), 2.2 Å
PDB Description: crystal structure analysis of tet repressor (class d) in complex with 7-chlortetracycline-nickel(ii)
PDB Compounds: (A:) tetracycline repressor protein class dSCOPe Domain Sequences for d2fj1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fj1a2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv
SCOPe Domain Coordinates for d2fj1a2:
Click to download the PDB-style file with coordinates for d2fj1a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fj1a2:
- d2fj1a2 first appeared in SCOP 1.73
- d2fj1a2 appears in SCOPe 2.07
View in 3D
