SCOP 1.75: Domain d2fj1a1: 2fj1 A:2-67

Lineage for d2fj1a1 (2fj1 A:2-67)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (19 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)

7. Species Escherichia coli [TaxId:562] [46766] (13 PDB entries)

8. Domain d2fj1a1: 2fj1 A:2-67 [133541]
   Other proteins in same PDB: d2fj1a2
   automatically matched to d1a6i_1
   complexed with cl, ctc, ni; mutant

Details for d2fj1a1

PDB Entry: 2fj1, 2.2 Å

PDB Description: crystal structure analysis of tet repressor (class d) in complex with 7-chlortetracycline-nickel(ii)

PDB Compounds: (A:) tetracycline repressor protein class d

SCOP Domain Sequences for d2fj1a1:

Sequence; same for both SEQRES and ATOM records:

>d2fj1a1 a.4.1.9 (A:2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

Timeline for d2fj1a1:

• d2fj1a1 first appeared in SCOP 1.73
  
• d2fj1a1 appears in SCOPe 2.01
  
• d2fj1a1 appears in the current release, SCOPe 2.08