Lineage for d2fj1a1 (2fj1 A:2-67)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634287Superfamily a.4.1: Homeodomain-like [46689] (17 families) (S)
    consists only of helices
  5. 634637Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (28 proteins)
  6. 634759Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)
  7. 634760Species Escherichia coli [TaxId:562] [46766] (11 PDB entries)
  8. 634762Domain d2fj1a1: 2fj1 A:2-67 [133541]
    Other proteins in same PDB: d2fj1a2
    automatically matched to d1a6i_1
    complexed with cl, ctc, ni; mutant

Details for d2fj1a1

PDB Entry: 2fj1 (more details), 2.2 Å

PDB Description: crystal structure analysis of tet repressor (class d) in complex with 7-chlortetracycline-nickel(ii)
PDB Compounds: (A:) tetracycline repressor protein class d

SCOP Domain Sequences for d2fj1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fj1a1 a.4.1.9 (A:2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

SCOP Domain Coordinates for d2fj1a1:

Click to download the PDB-style file with coordinates for d2fj1a1.
(The format of our PDB-style files is described here.)

Timeline for d2fj1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fj1a2