![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.59: FdhE-like [144019] (1 superfamily) consists on the N-terminal five-helical bundle, a tandem repeat of two rubredoxin-like domains and the C-terminal helix packed together |
![]() | Superfamily e.59.1: FdhE-like [144020] (1 family) ![]() automatically mapped to Pfam PF04216 |
![]() | Family e.59.1.1: FdhE-like [144021] (1 protein) Pfam PF04216 |
![]() | Protein FdhE homolog PA4809 [144022] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [144023] (1 PDB entry) Uniprot Q9HV00 19-308 |
![]() | Domain d2fiya1: 2fiy A:19-308 [133540] complexed with fe |
PDB Entry: 2fiy (more details), 2.1 Å
SCOPe Domain Sequences for d2fiya1:
Sequence, based on SEQRES records: (download)
>d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]} phlhqpsrdlfarrgerllqlaeghpmgdylrlvaglcrlqqalldnppalapldperlr ksrehgmpplaydllvregawlpwldallagypapanaavgaaleqlreaeegqrkawai allsgqfdllpaalvpflgaalqvawshwllgleegavvetesrtlcpacgsppmagmir qggketglrylscslcacewhyvrikcshceeskhlaylslehdgqpaekavlraetcps cqgylkqfylefdrhadaladdlaslaldmrlaedgylrrspnlllapgg
>d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]} phlhqpsrdlfarrgerllqlaeghpmgdylrlvaglcrlqqalldnppalapldperlr ksrehgmpplaydllvregawlpwldallagypapanaavgaaleqlreaeegqrkawai allsgqfdllpaalvpflgaalqvawshwllgleegavvetesrtlcpacgsppmagmir qtglrylscslcacewhyvrikcshceeskhlaylslehgqpaekavlraetcpscqgyl kqfylefdrhadaladdlaslaldmrlaedgylrrspnlllapgg
Timeline for d2fiya1: