Lineage for d2fiwa1 (2fiw A:0-157)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209198Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2209462Protein Probable N-acetyltransferase RPA1999 [143708] (1 species)
  7. 2209463Species Rhodopseudomonas palustris [TaxId:1076] [143709] (1 PDB entry)
    Uniprot Q6N8A5 2-157
  8. 2209464Domain d2fiwa1: 2fiw A:0-157 [133539]
    Other proteins in same PDB: d2fiwa2
    complexed with aco, so4

Details for d2fiwa1

PDB Entry: 2fiw (more details), 2.35 Å

PDB Description: crystal structure of the gcn5-related n-acetyltransferase: aminotransferase, class-ii from rhodopseudomonas palustris
PDB Compounds: (A:) GCN5-related N-acetyltransferase:Aminotransferase, class-II

SCOPe Domain Sequences for d2fiwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fiwa1 d.108.1.1 (A:0-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]}
mvmstpalrpylpedaavtaaifvasieqltaddyseeqqeawasaaddeakfaarlsgq
ltliatlqgvpvgfaslkgpdhidmlyvhpdyvgrdvgttlidaleklagargaliltvd
asdnaaeffakrgyvakqrntvsingewlanttmtksl

SCOPe Domain Coordinates for d2fiwa1:

Click to download the PDB-style file with coordinates for d2fiwa1.
(The format of our PDB-style files is described here.)

Timeline for d2fiwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fiwa2