Lineage for d2fiwa1 (2fiw A:0-157)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
3 layers: a/b/a; contains mixed beta-sheetSuperfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) 
Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) 
Protein Probable N-acetyltransferase RPA1999 [143708] (1 species) Species Rhodopseudomonas palustris [TaxId:1076] [143709] (1 PDB entry)
Uniprot Q6N8A5 2-157
Domain d2fiwa1: 2fiw A:0-157 [133539]
Other proteins in same PDB: d2fiwa2
complexed with aco, so4
Details for d2fiwa1
PDB Entry: 2fiw (more details), 2.35 Å
PDB Description: crystal structure of the gcn5-related n-acetyltransferase: aminotransferase, class-ii from rhodopseudomonas palustris
PDB Compounds: (A:) GCN5-related N-acetyltransferase:Aminotransferase, class-IISCOPe Domain Sequences for d2fiwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fiwa1 d.108.1.1 (A:0-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]}
mvmstpalrpylpedaavtaaifvasieqltaddyseeqqeawasaaddeakfaarlsgq
ltliatlqgvpvgfaslkgpdhidmlyvhpdyvgrdvgttlidaleklagargaliltvd
asdnaaeffakrgyvakqrntvsingewlanttmtksl
SCOPe Domain Coordinates for d2fiwa1:
Click to download the PDB-style file with coordinates for d2fiwa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fiwa1:
- d2fiwa1 first appeared in SCOP 1.73
- d2fiwa1 appears in SCOPe 2.07
View in 3D
