SCOPe 2.07: Domain d2fiub2: 2fiu B:1-95

Lineage for d2fiub2 (2fiu B:1-95)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.16: Atu0297-like [143275] (2 proteins)
   Pfam PF07045; DUF1330

6. Protein automated matches [190640] (1 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [187710] (1 PDB entry)

8. Domain d2fiub2: 2fiu B:1-95 [133538]
   Other proteins in same PDB: d2fiua1, d2fiua2, d2fiub3
   automated match to d2fiua1

Details for d2fiub2

PDB Entry: 2fiu, 2 Å

PDB Description: Crystal Structure of the Conserved Protein of Unknown Function ATU0297 from Agrobacterium tumefaciens

PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d2fiub2:

Sequence; same for both SEQRES and ATOM records:

>d2fiub2 d.58.4.16 (B:1-95) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
makgywiaqvdvrdserykdyvstakpaferfganflarggsvtelegtararnvviefp
svqhaidcynspeyqaaakirqevadaemmivegi

Timeline for d2fiub2:

• d2fiub2 first appeared in SCOP 1.73, called d2fiub1
  
• d2fiub2 appears in SCOPe 2.06
  
• d2fiub2 appears in the current release, SCOPe 2.08