SCOP 1.75: Domain d2fiub1: 2fiu B:1-95

Lineage for d2fiub1 (2fiu B:1-95)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (23 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.16: Atu0297-like [143275] (1 protein)
   Pfam PF07045; DUF1330

6. Protein Hypothetical protein Atu0297 [143276] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [143277] (1 PDB entry)
   Uniprot Q8UIJ7 1-95

8. Domain d2fiub1: 2fiu B:1-95 [133538]
   automatically matched to 2FIU A:1-95

Details for d2fiub1

PDB Entry: 2fiu, 2 Å

PDB Description: Crystal Structure of the Conserved Protein of Unknown Function ATU0297 from Agrobacterium tumefaciens

PDB Compounds: (B:) conserved hypothetical protein

SCOP Domain Sequences for d2fiub1:

Sequence; same for both SEQRES and ATOM records:

>d2fiub1 d.58.4.16 (B:1-95) Hypothetical protein Atu0297 {Agrobacterium tumefaciens [TaxId: 358]}
makgywiaqvdvrdserykdyvstakpaferfganflarggsvtelegtararnvviefp
svqhaidcynspeyqaaakirqevadaemmivegi

Timeline for d2fiub1:

• d2fiub1 first appeared in SCOP 1.73
  
• d2fiub1 is called d2fiub_ in SCOPe 2.01
  
• d2fiub1 appears in the current release, SCOPe 2.08, called d2fiub2