Lineage for d2fiub1 (2fiu B:1-95)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723747Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 723954Family d.58.4.16: Atu0297-like [143275] (1 protein)
    Pfam PF07045; DUF1330
  6. 723955Protein Hypothetical protein Atu0297 [143276] (1 species)
  7. 723956Species Agrobacterium tumefaciens [TaxId:358] [143277] (1 PDB entry)
  8. 723958Domain d2fiub1: 2fiu B:1-95 [133538]
    automatically matched to 2FIU A:1-95

Details for d2fiub1

PDB Entry: 2fiu (more details), 2 Å

PDB Description: Crystal Structure of the Conserved Protein of Unknown Function ATU0297 from Agrobacterium tumefaciens
PDB Compounds: (B:) conserved hypothetical protein

SCOP Domain Sequences for d2fiub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fiub1 d.58.4.16 (B:1-95) Hypothetical protein Atu0297 {Agrobacterium tumefaciens [TaxId: 358]}
makgywiaqvdvrdserykdyvstakpaferfganflarggsvtelegtararnvviefp
svqhaidcynspeyqaaakirqevadaemmivegi

SCOP Domain Coordinates for d2fiub1:

Click to download the PDB-style file with coordinates for d2fiub1.
(The format of our PDB-style files is described here.)

Timeline for d2fiub1: