Lineage for d2fiub2 (2fiu B:1-95)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. Family d.58.4.16: Atu0297-like [143275] (2 proteins)
    Pfam PF07045; DUF1330
  6. Protein automated matches [190640] (1 species)
    not a true protein
  7. Species Agrobacterium tumefaciens [TaxId:176299] [187710] (1 PDB entry)
  8. Domain d2fiub2: 2fiu B:1-95 [133538]
    Other proteins in same PDB: d2fiua1, d2fiua2, d2fiub3
    automated match to d2fiua1

Details for d2fiub2

PDB Entry: 2fiu (more details), 2 Å

PDB Description: Crystal Structure of the Conserved Protein of Unknown Function ATU0297 from Agrobacterium tumefaciens
PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d2fiub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fiub2 d.58.4.16 (B:1-95) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
makgywiaqvdvrdserykdyvstakpaferfganflarggsvtelegtararnvviefp
svqhaidcynspeyqaaakirqevadaemmivegi

SCOPe Domain Coordinates for d2fiub2 are not available.

Timeline for d2fiub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fiub3
View in 3D
Domains from other chains:
(mouse over for more information)
d2fiua1, d2fiua2