SCOPe 2.07: Domain d2fiua1: 2fiu A:1-95

Lineage for d2fiua1 (2fiu A:1-95)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.16: Atu0297-like [143275] (2 proteins)
   Pfam PF07045; DUF1330

6. Protein Hypothetical protein Atu0297 [143276] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [143277] (1 PDB entry)
   Uniprot Q8UIJ7 1-95

8. Domain d2fiua1: 2fiu A:1-95 [133537]
   Other proteins in same PDB: d2fiua2, d2fiub2, d2fiub3

Details for d2fiua1

PDB Entry: 2fiu, 2 Å

PDB Description: Crystal Structure of the Conserved Protein of Unknown Function ATU0297 from Agrobacterium tumefaciens

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d2fiua1:

Sequence; same for both SEQRES and ATOM records:

>d2fiua1 d.58.4.16 (A:1-95) Hypothetical protein Atu0297 {Agrobacterium tumefaciens [TaxId: 358]}
makgywiaqvdvrdserykdyvstakpaferfganflarggsvtelegtararnvviefp
svqhaidcynspeyqaaakirqevadaemmivegi

Timeline for d2fiua1:

• d2fiua1 first appeared in SCOP 1.73
  
• d2fiua1 appears in SCOPe 2.06
  
• d2fiua1 appears in the current release, SCOPe 2.08