![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (43 proteins) Pfam PF00041 |
![]() | Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (18 PDB entries) |
![]() | Domain d2firt1: 2fir T:6-108 [133535] Other proteins in same PDB: d2firh1, d2firl1, d2firl2, d2firl3 automatically matched to d1a21a1 complexed with ca, cl, fuc, glc, mg, na, zn |
PDB Entry: 2fir (more details), 2 Å
SCOP Domain Sequences for d2firt1:
Sequence, based on SEQRES records: (download)
>d2firt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk dvkqtylarvfsypagnvestgsageplyenspeftpyletnl
>d2firt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk dvkqtylarvfsypagngeplyenspeftpyletnl
Timeline for d2firt1:
![]() Domains from other chains: (mouse over for more information) d2firh1, d2firl1, d2firl2, d2firl3 |