![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (7 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (22 proteins) |
![]() | Protein Factor IX (IXa) [57198] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries) |
![]() | Domain d2firl2: 2fir L:91-140 [133533] Other proteins in same PDB: d2firh1, d2firl3, d2firt1, d2firt2 automatically matched to d1pfxl2 complexed with ca, cl, fuc, glc, mg, na, zn |
PDB Entry: 2fir (more details), 2 Å
SCOP Domain Sequences for d2firl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2firl2 g.3.11.1 (L:91-140) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} cvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipi
Timeline for d2firl2: