Lineage for d2firl1 (2fir L:46-82)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1240201Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1240965Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 1240966Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1240975Protein Coagulation factor VIIa [57201] (1 species)
  7. 1240976Species Human (Homo sapiens) [TaxId:9606] [57202] (35 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 1240990Domain d2firl1: 2fir L:46-82 [133532]
    Other proteins in same PDB: d2firh_, d2firl3, d2firt1, d2firt2
    automatically matched to d1pfxl1
    complexed with 0g7, ca, cl, fuc, glc, mg, na, zn

Details for d2firl1

PDB Entry: 2fir (more details), 2 Å

PDB Description: crystal structure of dfpr-viia/stf
PDB Compounds: (L:) Coagulation factor VII light chain

SCOPe Domain Sequences for d2firl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2firl1 g.3.11.1 (L:46-82) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dgdqcasspcqnggsckdqlqsyicfclpafegrnce

SCOPe Domain Coordinates for d2firl1:

Click to download the PDB-style file with coordinates for d2firl1.
(The format of our PDB-style files is described here.)

Timeline for d2firl1: