![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein CD1, alpha-3 domain [88615] (4 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88616] (7 PDB entries) |
![]() | Domain d2fika1: 2fik A:186-279 [133524] Other proteins in same PDB: d2fika2, d2fikb_ automatically matched to d1cd1a1 complexed with gsl, nag, plm |
PDB Entry: 2fik (more details), 1.8 Å
SCOPe Domain Sequences for d2fika1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fika1 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilyw
Timeline for d2fika1: