SCOP 1.75: Domain d2fiff1: 2fif F:17-72

Lineage for d2fiff1 (2fif F:17-72)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families)

5. Family g.39.1.15: A20-like zinc finger [144187] (1 protein)
   Pfam PF01754

6. Protein RabGEF1 (Rabex-5), ubiquitin-binding domain [144188] (2 species)
   binds to ubiquitin with the extended C-terminal helix

7. Species Cow (Bos taurus) [TaxId:9913] [144189] (2 PDB entries)
   Uniprot O18973 14-73

8. Domain d2fiff1: 2fif F:17-72 [133523]
   Other proteins in same PDB: d2fifa1, d2fifc1, d2fife1
   automatically matched to 2FID B:14-73
   complexed with so4, zn

Details for d2fiff1

PDB Entry: 2fif, 2.49 Å

PDB Description: Crystal Structure of a Bovine Rabex-5 fragment complexed with ubiquitin

PDB Compounds: (F:) Rab5 GDP/GTP exchange factor

SCOP Domain Sequences for d2fiff1:

Sequence; same for both SEQRES and ATOM records:

>d2fiff1 g.39.1.15 (F:17-72) RabGEF1 (Rabex-5), ubiquitin-binding domain {Cow (Bos taurus) [TaxId: 9913]}
llckkgcgyygnpawqgfcskcwreeyhkarqkqiqedwelaerlqreeeeafass

Timeline for d2fiff1:

• d2fiff1 first appeared in SCOP 1.73
  
• d2fiff1 is called d2fiff_ in SCOPe 2.01
  
• d2fiff1 appears in the current release, SCOPe 2.08, called d2fiff_