Lineage for d2fiff1 (2fif F:17-72)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750235Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 750236Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) (S)
  5. 750641Family g.39.1.15: A20-like zinc finger [144187] (1 protein)
    Pfam PF01754
  6. 750642Protein RabGEF1 (Rabex-5), ubiquitin-binding domain [144188] (2 species)
    binds to ubiquitin with the extended C-terminal helix
  7. 750643Species Cow (Bos taurus) [TaxId:9913] [144189] (2 PDB entries)
  8. 750646Domain d2fiff1: 2fif F:17-72 [133523]
    Other proteins in same PDB: d2fifa1, d2fifc1, d2fife1
    automatically matched to 2FID B:14-73
    complexed with so4, zn

Details for d2fiff1

PDB Entry: 2fif (more details), 2.49 Å

PDB Description: Crystal Structure of a Bovine Rabex-5 fragment complexed with ubiquitin
PDB Compounds: (F:) Rab5 GDP/GTP exchange factor

SCOP Domain Sequences for d2fiff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fiff1 g.39.1.15 (F:17-72) RabGEF1 (Rabex-5), ubiquitin-binding domain {Cow (Bos taurus) [TaxId: 9913]}
llckkgcgyygnpawqgfcskcwreeyhkarqkqiqedwelaerlqreeeeafass

SCOP Domain Coordinates for d2fiff1:

Click to download the PDB-style file with coordinates for d2fiff1.
(The format of our PDB-style files is described here.)

Timeline for d2fiff1: