SCOP 1.75: Domain d2fiaa1: 2fia A:1-157

Lineage for d2fiaa1 (2fia A:1-157)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (57 proteins)

6. Protein Probable acetyltransferase EF1919 [143662] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [143663] (1 PDB entry)
   Uniprot Q833M5 1-157

8. Domain d2fiaa1: 2fia A:1-157 [133514]

Details for d2fiaa1

PDB Entry: 2fia, 2.6 Å

PDB Description: The crystal structure of the acetyltransferase from Enterococcus faecalis

PDB Compounds: (A:) Acetyltransferase

SCOP Domain Sequences for d2fiaa1:

Sequence; same for both SEQRES and ATOM records:

>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]}
mkirvadekelpmilqfltevkaymdvvgitqwtkdypsqgdiqeditkkrlyllvheem
ifsmatfcmeqeqdfvwlkrfatspnyiakgygsllfhelekravwegrrkmyaqtnhtn
hrmirffeskgftkiheslqmnrldfgsfylyvkele

Timeline for d2fiaa1:

• d2fiaa1 first appeared in SCOP 1.73
  
• d2fiaa1 appears in SCOPe 2.01
  
• d2fiaa1 appears in the current release, SCOPe 2.08