Lineage for d2fiaa1 (2fia A:1-157)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533436Protein Probable acetyltransferase EF1919 [143662] (1 species)
  7. 2533437Species Enterococcus faecalis [TaxId:1351] [143663] (1 PDB entry)
    Uniprot Q833M5 1-157
  8. 2533438Domain d2fiaa1: 2fia A:1-157 [133514]

Details for d2fiaa1

PDB Entry: 2fia (more details), 2.6 Å

PDB Description: The crystal structure of the acetyltransferase from Enterococcus faecalis
PDB Compounds: (A:) Acetyltransferase

SCOPe Domain Sequences for d2fiaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]}
mkirvadekelpmilqfltevkaymdvvgitqwtkdypsqgdiqeditkkrlyllvheem
ifsmatfcmeqeqdfvwlkrfatspnyiakgygsllfhelekravwegrrkmyaqtnhtn
hrmirffeskgftkiheslqmnrldfgsfylyvkele

SCOPe Domain Coordinates for d2fiaa1:

Click to download the PDB-style file with coordinates for d2fiaa1.
(The format of our PDB-style files is described here.)

Timeline for d2fiaa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fiab_