Lineage for d2fi9a1 (2fi9 A:11-128)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1882926Fold c.103: MTH938-like [64075] (1 superfamily)
    core: 3 layers, b+a/b/a ; the central mixed sheet of 5 strands: order 21534; strand 2 is antiparallel to the rest
  4. 1882927Superfamily c.103.1: MTH938-like [64076] (1 family) (S)
    automatically mapped to Pfam PF04430
  5. 1882928Family c.103.1.1: MTH938-like [64077] (5 proteins)
  6. 1882929Protein Hypothetical outer membrane protein BH05650 [142439] (1 species)
  7. 1882930Species Bartonella henselae [TaxId:38323] [142440] (1 PDB entry)
    Uniprot Q8RIU4 11-128
  8. 1882931Domain d2fi9a1: 2fi9 A:11-128 [133513]

Details for d2fi9a1

PDB Entry: 2fi9 (more details), 1.8 Å

PDB Description: the crystal structure of an outer membrane protein from the bartonella henselae
PDB Compounds: (A:) Outer membrane protein

SCOPe Domain Sequences for d2fi9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fi9a1 c.103.1.1 (A:11-128) Hypothetical outer membrane protein BH05650 {Bartonella henselae [TaxId: 38323]}
hfpgrapidaygnggfrfadmshrgsiicipsgiygidmtgpvptqedisrvleesdqie
vlligtgvellrlpeelrvllwekrissdtmstgaavrtfnvllaedravaallfave

SCOPe Domain Coordinates for d2fi9a1:

Click to download the PDB-style file with coordinates for d2fi9a1.
(The format of our PDB-style files is described here.)

Timeline for d2fi9a1: