SCOPe 2.04: Domain d2fi9a1: 2fi9 A:11-128

Lineage for d2fi9a1 (2fi9 A:11-128)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.103: MTH938-like [64075] (1 superfamily)
   core: 3 layers, b+a/b/a ; the central mixed sheet of 5 strands: order 21534; strand 2 is antiparallel to the rest

4. Superfamily c.103.1: MTH938-like [64076] (1 family)
   automatically mapped to Pfam PF04430

5. Family c.103.1.1: MTH938-like [64077] (5 proteins)

6. Protein Hypothetical outer membrane protein BH05650 [142439] (1 species)

7. Species Bartonella henselae [TaxId:38323] [142440] (1 PDB entry)
   Uniprot Q8RIU4 11-128

8. Domain d2fi9a1: 2fi9 A:11-128 [133513]

Details for d2fi9a1

PDB Entry: 2fi9, 1.8 Å

PDB Description: the crystal structure of an outer membrane protein from the bartonella henselae

PDB Compounds: (A:) Outer membrane protein

SCOPe Domain Sequences for d2fi9a1:

Sequence; same for both SEQRES and ATOM records:

>d2fi9a1 c.103.1.1 (A:11-128) Hypothetical outer membrane protein BH05650 {Bartonella henselae [TaxId: 38323]}
hfpgrapidaygnggfrfadmshrgsiicipsgiygidmtgpvptqedisrvleesdqie
vlligtgvellrlpeelrvllwekrissdtmstgaavrtfnvllaedravaallfave

Timeline for d2fi9a1:

• d2fi9a1 first appeared in SCOP 1.73
  
• d2fi9a1 appears in SCOPe 2.03
  
• d2fi9a1 appears in SCOPe 2.05
  
• d2fi9a1 appears in the current release, SCOPe 2.08