Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.103: MTH938-like [64075] (1 superfamily) core: 3 layers, b+a/b/a ; the central mixed sheet of 5 strands: order 21534; strand 2 is antiparallel to the rest |
Superfamily c.103.1: MTH938-like [64076] (1 family) automatically mapped to Pfam PF04430 |
Family c.103.1.1: MTH938-like [64077] (5 proteins) |
Protein Hypothetical outer membrane protein BH05650 [142439] (1 species) |
Species Bartonella henselae [TaxId:38323] [142440] (1 PDB entry) Uniprot Q8RIU4 11-128 |
Domain d2fi9a1: 2fi9 A:11-128 [133513] |
PDB Entry: 2fi9 (more details), 1.8 Å
SCOPe Domain Sequences for d2fi9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fi9a1 c.103.1.1 (A:11-128) Hypothetical outer membrane protein BH05650 {Bartonella henselae [TaxId: 38323]} hfpgrapidaygnggfrfadmshrgsiicipsgiygidmtgpvptqedisrvleesdqie vlligtgvellrlpeelrvllwekrissdtmstgaavrtfnvllaedravaallfave
Timeline for d2fi9a1: