Lineage for d2fi2b1 (2fi2 B:37-128)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639734Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 639818Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (2 families) (S)
  5. 639840Family a.28.3.2: SCAN domain [140466] (2 proteins)
    Pfam PF02023; forms segment-swapped dimers compared to the retroviral capsid domain
  6. 639845Protein Zinc finger protein 42 [140467] (1 species)
  7. 639846Species Human (Homo sapiens) [TaxId:9606] [140468] (1 PDB entry)
  8. 639848Domain d2fi2b1: 2fi2 B:37-128 [133510]
    automatically matched to 2FI2 A:37-128

Details for d2fi2b1

PDB Entry: 2fi2 (more details)

PDB Description: solution structure of the scan homodimer from mzf-1/znf42
PDB Compounds: (B:) Zinc finger protein 42

SCOP Domain Sequences for d2fi2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fi2b1 a.28.3.2 (B:37-128) Zinc finger protein 42 {Human (Homo sapiens) [TaxId: 9606]}
dpgpeaarlrfrcfhyeeatgpqealaqlrelcrqwlrpevrskeqmlellvleqflgal
ppeiqarvqgqrpgspeeaaalvdglrrepgg

SCOP Domain Coordinates for d2fi2b1:

Click to download the PDB-style file with coordinates for d2fi2b1.
(The format of our PDB-style files is described here.)

Timeline for d2fi2b1: