SCOPe 2.08: Domain d2fi2b2: 2fi2 B:37-128

Lineage for d2fi2b2 (2fi2 B:37-128)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.2: SCAN domain [140466] (2 proteins)
   Pfam PF02023; forms segment-swapped dimers compared to the retroviral capsid domain

6. Protein Zinc finger protein 42 [140467] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140468] (1 PDB entry)
   Uniprot P28698 37-128

8. Domain d2fi2b2: 2fi2 B:37-128 [133510]
   Other proteins in same PDB: d2fi2a2, d2fi2b3
   automated match to d2fi2a1

Details for d2fi2b2

PDB Entry: 2fi2

PDB Description: solution structure of the scan homodimer from mzf-1/znf42

PDB Compounds: (B:) Zinc finger protein 42

SCOPe Domain Sequences for d2fi2b2:

Sequence; same for both SEQRES and ATOM records:

>d2fi2b2 a.28.3.2 (B:37-128) Zinc finger protein 42 {Human (Homo sapiens) [TaxId: 9606]}
dpgpeaarlrfrcfhyeeatgpqealaqlrelcrqwlrpevrskeqmlellvleqflgal
ppeiqarvqgqrpgspeeaaalvdglrrepgg

Timeline for d2fi2b2:

• d2fi2b2 first appeared in SCOP 1.73, called d2fi2b1
  
• d2fi2b2 appears in SCOPe 2.07