SCOP 1.73: Domain d2fi1a1: 2fi1 A:4-190

Lineage for d2fi1a1 (2fi1 A:4-190)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (23 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.3: Phosphonoacetaldehyde hydrolase-like [56792] (2 proteins)
   the insertion subdomain is a 4-helical bundle

6. Protein Putative hydrolase SP0805 [142151] (1 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [142152] (1 PDB entry)

8. Domain d2fi1a1: 2fi1 A:4-190 [133508]
   complexed with ca

Details for d2fi1a1

PDB Entry: 2fi1, 1.4 Å

PDB Description: The crystal structure of a hydrolase from Streptococcus pneumoniae TIGR4

PDB Compounds: (A:) Hydrolase, haloacid dehalogenase-like family

SCOP Domain Sequences for d2fi1a1:

Sequence; same for both SEQRES and ATOM records:

>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]}
mkyhdyiwdlggtlldnyetstaafvetlalygitqdhdsvyqalkvstpfaietfapnl
enflekykenearelehpilfegvsdlledisnqggrhflvshrndqvleilektsiaay
ftevvtsssgfkrkpnpesmlylrekyqissglvigdrpidieagqaagldthlftsivn
lrqvldi

Timeline for d2fi1a1:

• d2fi1a1 is new in SCOP 1.73
  
• d2fi1a1 appears in SCOP 1.75
  
• d2fi1a1 appears in the current release, SCOPe 2.08