Lineage for d2fi1a1 (2fi1 A:4-190)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919616Family c.108.1.3: Phosphonoacetaldehyde hydrolase-like [56792] (3 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 2919637Protein Putative hydrolase SP0805 [142151] (1 species)
  7. 2919638Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [142152] (1 PDB entry)
    Uniprot Q97RK1 4-190
  8. 2919639Domain d2fi1a1: 2fi1 A:4-190 [133508]
    complexed with ca

Details for d2fi1a1

PDB Entry: 2fi1 (more details), 1.4 Å

PDB Description: The crystal structure of a hydrolase from Streptococcus pneumoniae TIGR4
PDB Compounds: (A:) Hydrolase, haloacid dehalogenase-like family

SCOPe Domain Sequences for d2fi1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mkyhdyiwdlggtlldnyetstaafvetlalygitqdhdsvyqalkvstpfaietfapnl
enflekykenearelehpilfegvsdlledisnqggrhflvshrndqvleilektsiaay
ftevvtsssgfkrkpnpesmlylrekyqissglvigdrpidieagqaagldthlftsivn
lrqvldi

SCOPe Domain Coordinates for d2fi1a1:

Click to download the PDB-style file with coordinates for d2fi1a1.
(The format of our PDB-style files is described here.)

Timeline for d2fi1a1: