![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.3: Phosphonoacetaldehyde hydrolase-like [56792] (3 proteins) the insertion subdomain is a 4-helical bundle |
![]() | Protein Putative hydrolase SP0805 [142151] (1 species) |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [142152] (1 PDB entry) Uniprot Q97RK1 4-190 |
![]() | Domain d2fi1a1: 2fi1 A:4-190 [133508] complexed with ca |
PDB Entry: 2fi1 (more details), 1.4 Å
SCOPe Domain Sequences for d2fi1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} mkyhdyiwdlggtlldnyetstaafvetlalygitqdhdsvyqalkvstpfaietfapnl enflekykenearelehpilfegvsdlledisnqggrhflvshrndqvleilektsiaay ftevvtsssgfkrkpnpesmlylrekyqissglvigdrpidieagqaagldthlftsivn lrqvldi
Timeline for d2fi1a1: