Lineage for d2fi0a1 (2fi0 A:3-81)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738275Fold a.248: SP0561-like [140682] (1 superfamily)
    5 helices; array; includes extra N-terminal and C-terminal short strands forming parrallel beta-sheet ladder
  4. 2738276Superfamily a.248.1: SP0561-like [140683] (1 family) (S)
  5. 2738277Family a.248.1.1: SP0561-like [140684] (1 protein)
    Pfam PF08984; DUF1858
  6. 2738278Protein Hypothetical protein SPr0485/SP0561 [140685] (1 species)
  7. 2738279Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [140686] (1 PDB entry)
    Uniprot Q8CZ42 3-81
  8. 2738280Domain d2fi0a1: 2fi0 A:3-81 [133507]

Details for d2fi0a1

PDB Entry: 2fi0 (more details), 2.1 Å

PDB Description: the crystal structure of the conserved domain protein from streptococcus pneumoniae tigr4
PDB Compounds: (A:) conserved domain protein

SCOPe Domain Sequences for d2fi0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fi0a1 a.248.1.1 (A:3-81) Hypothetical protein SPr0485/SP0561 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
vvmdniidvsipvaevvdkhpevleilvelgfkplanplmrntvgrkvslkqgsklagtp
mdkivrtleangyevigld

SCOPe Domain Coordinates for d2fi0a1:

Click to download the PDB-style file with coordinates for d2fi0a1.
(The format of our PDB-style files is described here.)

Timeline for d2fi0a1: