SCOPe 2.06: Domain d2fhzb_: 2fhz B:

Lineage for d2fhzb_ (2fhz B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.243: Colicin D/E5 nuclease domain [102823] (1 superfamily)
   alpha(2)-beta(4)-alpha, 2 layers: alpha/beta, antiparallel beta sheet, meander

4. Superfamily d.243.1: Colicin D/E5 nuclease domain [102824] (2 families)

5. Family d.243.1.2: Colicin E5 nuclease domain [143007] (2 proteins)

6. Protein Colicin E5 [143008] (1 species)

7. Species Escherichia coli [TaxId:562] [143009] (4 PDB entries)
   Uniprot P18000 84-177

8. Domain d2fhzb_: 2fhz B: [133506]
   Other proteins in same PDB: d2fhza1, d2fhza2
   automated match to d2a8ka1

Details for d2fhzb_

PDB Entry: 2fhz, 1.15 Å

PDB Description: Molecular Basis of Inhibition of the Ribonuclease Activity in Colicin E5 by Its Cognate Immunity Protein

PDB Compounds: (B:) Colicin-E5

SCOPe Domain Sequences for d2fhzb_:

Sequence; same for both SEQRES and ATOM records:

>d2fhzb_ d.243.1.2 (B:) Colicin E5 {Escherichia coli [TaxId: 562]}
lkidqkirgqmpergwteddikntvsngatgtsfdkrspkktppdylgrndpatvygspg
kyvvvndrtgevtqisdktdpgwvddsriqwgn

Timeline for d2fhzb_:

• d2fhzb_ first appeared in SCOP 1.73, called d2fhzb1
  
• d2fhzb_ appears in SCOPe 2.05
  
• d2fhzb_ appears in SCOPe 2.07
  
• d2fhzb_ appears in the current release, SCOPe 2.08