SCOP 1.73: Domain d2fhzb1: 2fhz B:12-104

Lineage for d2fhzb1 (2fhz B:12-104)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.243: Colicin D/E5 nuclease domain [102823] (1 superfamily)
   alpha(2)-beta(4)-alpha, 2 layers: alpha/beta, antiparallel beta sheet, meander

4. Superfamily d.243.1: Colicin D/E5 nuclease domain [102824] (2 families)

5. Family d.243.1.2: Colicin E5 nuclease domain [143007] (1 protein)

6. Protein Colicin E5 [143008] (1 species)

7. Species Escherichia coli [TaxId:562] [143009] (4 PDB entries)

8. Domain d2fhzb1: 2fhz B:12-104 [133506]
   Other proteins in same PDB: d2fhza1
   automatically matched to 2A8K A:12-105

Details for d2fhzb1

PDB Entry: 2fhz, 1.15 Å

PDB Description: Molecular Basis of Inhibition of the Ribonuclease Activity in Colicin E5 by Its Cognate Immunity Protein

PDB Compounds: (B:) Colicin-E5

SCOP Domain Sequences for d2fhzb1:

Sequence; same for both SEQRES and ATOM records:

>d2fhzb1 d.243.1.2 (B:12-104) Colicin E5 {Escherichia coli [TaxId: 562]}
lkidqkirgqmpergwteddikntvsngatgtsfdkrspkktppdylgrndpatvygspg
kyvvvndrtgevtqisdktdpgwvddsriqwgn

Timeline for d2fhzb1:

• d2fhzb1 is new in SCOP 1.73
  
• d2fhzb1 appears in SCOP 1.75
  
• d2fhzb1 appears in the current release, SCOPe 2.08, called d2fhzb_