Lineage for d2fhza1 (2fhz A:27-109)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616425Fold d.311: ImmE5-like [143468] (1 superfamily)
    alpha-beta(2)-alpha-beta; 2 layers, a/b; antiparallel beta-sheet, order 213
  4. 2616426Superfamily d.311.1: ImmE5-like [143469] (1 family) (S)
    automatically mapped to Pfam PF11480
  5. 2616427Family d.311.1.1: ImmE5-like [143470] (1 protein)
  6. 2616428Protein Colicin E5 immunity protein ImmE5 [143471] (1 species)
  7. 2616429Species Escherichia coli [TaxId:562] [143472] (2 PDB entries)
    Uniprot P13476 1-83
  8. 2616430Domain d2fhza1: 2fhz A:27-109 [133505]
    Other proteins in same PDB: d2fhza2, d2fhzb_

Details for d2fhza1

PDB Entry: 2fhz (more details), 1.15 Å

PDB Description: Molecular Basis of Inhibition of the Ribonuclease Activity in Colicin E5 by Its Cognate Immunity Protein
PDB Compounds: (A:) Colicin-E5 immunity protein

SCOPe Domain Sequences for d2fhza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhza1 d.311.1.1 (A:27-109) Colicin E5 immunity protein ImmE5 {Escherichia coli [TaxId: 562]}
mklspkaaievcneaakkglwilgidgghwlnpgfridssaswtydmpeeykskipennr
laienikddiengytafiitlkm

SCOPe Domain Coordinates for d2fhza1:

Click to download the PDB-style file with coordinates for d2fhza1.
(The format of our PDB-style files is described here.)

Timeline for d2fhza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fhza2
View in 3D
Domains from other chains:
(mouse over for more information)
d2fhzb_