SCOPe 2.08: Domain d2fhsc_: 2fhs C:

Lineage for d2fhsc_ (2fhs C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)

6. Protein Acyl carrier protein [47338] (7 species)

7. Species Escherichia coli [TaxId:562] [47339] (26 PDB entries)
   Uniprot P02901

8. Domain d2fhsc_: 2fhs C: [133503]
   Other proteins in same PDB: d2fhsa_, d2fhsb_
   automated match to d1acp__
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2fhsc_

PDB Entry: 2fhs, 2.7 Å

PDB Description: Structure of Acyl Carrier Protein Bound to FabI, the Enoyl Reductase from Escherichia Coli

PDB Compounds: (C:) Acyl carrier protein

SCOPe Domain Sequences for d2fhsc_:

Sequence, based on SEQRES records:

>d2fhsc_ a.28.1.1 (C:) Acyl carrier protein {Escherichia coli [TaxId: 562]}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyinghq

Sequence, based on observed residues (ATOM records):

>d2fhsc_ a.28.1.1 (C:) Acyl carrier protein {Escherichia coli [TaxId: 562]}
stieerviigvkqeevtnnfvedlgasldtvelvmaleeefdtttvqaaidyinghq

Timeline for d2fhsc_:

• d2fhsc_ first appeared in SCOP 1.73, called d2fhsc1
  
• d2fhsc_ appears in SCOPe 2.07