Lineage for d2fhsb_ (2fhs B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2102904Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2103489Protein Enoyl-ACP reductase [51791] (11 species)
  7. 2103506Species Escherichia coli [TaxId:562] [51794] (13 PDB entries)
  8. 2103542Domain d2fhsb_: 2fhs B: [133502]
    Other proteins in same PDB: d2fhsc_
    automated match to d1qsgg_

Details for d2fhsb_

PDB Entry: 2fhs (more details), 2.7 Å

PDB Description: Structure of Acyl Carrier Protein Bound to FabI, the Enoyl Reductase from Escherichia Coli
PDB Compounds: (B:) enoyl-[acyl-carrier-protein] reductase, NADH-dependent

SCOPe Domain Sequences for d2fhsb_:

Sequence, based on SEQRES records: (download)

>d2fhsb_ c.2.1.2 (B:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]}
gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
gevvhvdggfsiaamnel

Sequence, based on observed residues (ATOM records): (download)

>d2fhsb_ c.2.1.2 (B:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]}
gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
vrvnaisagpirtikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagisgevvh
vdggfsiaamnel

SCOPe Domain Coordinates for d2fhsb_:

Click to download the PDB-style file with coordinates for d2fhsb_.
(The format of our PDB-style files is described here.)

Timeline for d2fhsb_: