Lineage for d2fhra2 (2fhr A:0-400)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1802176Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1802177Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1802178Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 1802440Protein automated matches [193245] (15 species)
    not a true protein
  7. 1802557Species Trypanosoma rangeli [TaxId:5698] [255026] (3 PDB entries)
  8. 1802560Domain d2fhra2: 2fhr A:0-400 [133500]
    Other proteins in same PDB: d2fhra1
    automated match to d1n1ta2
    complexed with fsi, gol, so4

Details for d2fhra2

PDB Entry: 2fhr (more details), 2.2 Å

PDB Description: Trypanosoma Rangeli Sialidase In Complex With 2,3- Difluorosialic Acid (Covalent Intermediate)
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d2fhra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhra2 b.68.1.1 (A:0-400) automated matches {Trypanosoma rangeli [TaxId: 5698]}
slapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryetsf
dnsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnktrn
swtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefigg
vgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavleweg
kliinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtiegkr
vmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslhei
ntndvyslvfvrligelqlmksvvrtwkeednhlasictpv

SCOPe Domain Coordinates for d2fhra2:

Click to download the PDB-style file with coordinates for d2fhra2.
(The format of our PDB-style files is described here.)

Timeline for d2fhra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fhra1