Lineage for d2fhra1 (2fhr A:408-631)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (57 species)
    not a true protein
  7. 2375702Species Trypanosoma rangeli [TaxId:5698] [255027] (3 PDB entries)
  8. 2375704Domain d2fhra1: 2fhr A:408-631 [133499]
    Other proteins in same PDB: d2fhra2, d2fhra3
    automated match to d1n1ta1
    complexed with fsi, gol, so4

Details for d2fhra1

PDB Entry: 2fhr (more details), 2.2 Å

PDB Description: Trypanosoma Rangeli Sialidase In Complex With 2,3- Difluorosialic Acid (Covalent Intermediate)
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d2fhra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhra1 b.29.1.0 (A:408-631) automated matches {Trypanosoma rangeli [TaxId: 5698]}
kggcgaavptaglvgflshsangsvwedvyrcvdanvanaervpnglkfngvgggavwpv
arqgqtrryqfanyrftlvatvtidelpkgtspllgaglegpgdakllglsydknrqwrp
lygaapasptgswelhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyi
ggprskgaptdsrvtvtnvvlynrrlnsseirtlflsqdmigtd

SCOPe Domain Coordinates for d2fhra1:

Click to download the PDB-style file with coordinates for d2fhra1.
(The format of our PDB-style files is described here.)

Timeline for d2fhra1: