SCOPe 2.04: Domain d2fhqb_: 2fhq B:

Lineage for d2fhqb_ (2fhq B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)

6. Protein automated matches [190383] (4 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:226186] [187708] (1 PDB entry)

8. Domain d2fhqb_: 2fhq B: [133498]
   Other proteins in same PDB: d2fhqa1
   automated match to d2fhqa1

Details for d2fhqb_

PDB Entry: 2fhq, 1.87 Å

PDB Description: Crystal Structure of General Stress Protein from Bacteroides thetaiotaomicron

PDB Compounds: (B:) putative general stress protein

SCOPe Domain Sequences for d2fhqb_:

Sequence; same for both SEQRES and ATOM records:

>d2fhqb_ b.45.1.1 (B:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
ktmkekavellqkcevvtlasvnkegyprpvpmskiaaegistiwmstgadslktidfls
npkaglcfqekgdsvalmgevevvtdeklkqelwqdwfiehfpggptdpgyvllkftanh
atywiegtfihkkl

Timeline for d2fhqb_:

• d2fhqb_ first appeared in SCOP 1.73, called d2fhqb1
  
• d2fhqb_ appears in SCOPe 2.03
  
• d2fhqb_ appears in SCOPe 2.05
  
• d2fhqb_ appears in the current release, SCOPe 2.08