Lineage for d2fhqb_ (2fhq B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952712Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 952713Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 952714Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 952818Protein automated matches [190383] (4 species)
    not a true protein
  7. 952819Species Bacteroides thetaiotaomicron [TaxId:226186] [187708] (1 PDB entry)
  8. 952820Domain d2fhqb_: 2fhq B: [133498]
    Other proteins in same PDB: d2fhqa1
    automated match to d2fhqa1

Details for d2fhqb_

PDB Entry: 2fhq (more details), 1.87 Å

PDB Description: Crystal Structure of General Stress Protein from Bacteroides thetaiotaomicron
PDB Compounds: (B:) putative general stress protein

SCOPe Domain Sequences for d2fhqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhqb_ b.45.1.1 (B:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
ktmkekavellqkcevvtlasvnkegyprpvpmskiaaegistiwmstgadslktidfls
npkaglcfqekgdsvalmgevevvtdeklkqelwqdwfiehfpggptdpgyvllkftanh
atywiegtfihkkl

SCOPe Domain Coordinates for d2fhqb_:

Click to download the PDB-style file with coordinates for d2fhqb_.
(The format of our PDB-style files is described here.)

Timeline for d2fhqb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fhqa1