![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
![]() | Protein automated matches [190383] (4 species) not a true protein |
![]() | Species Bacteroides thetaiotaomicron [TaxId:226186] [187708] (1 PDB entry) |
![]() | Domain d2fhqb_: 2fhq B: [133498] Other proteins in same PDB: d2fhqa1 automated match to d2fhqa1 |
PDB Entry: 2fhq (more details), 1.87 Å
SCOPe Domain Sequences for d2fhqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fhqb_ b.45.1.1 (B:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} ktmkekavellqkcevvtlasvnkegyprpvpmskiaaegistiwmstgadslktidfls npkaglcfqekgdsvalmgevevvtdeklkqelwqdwfiehfpggptdpgyvllkftanh atywiegtfihkkl
Timeline for d2fhqb_: