SCOP 1.73: Domain d2fhqb1: 2fhq B:4-137

Lineage for d2fhqb1 (2fhq B:4-137)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.45: Split barrel-like [50474] (2 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (3 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (16 proteins)

6. Protein Putative general stress protein BT1439 [141358] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [141359] (1 PDB entry)

8. Domain d2fhqb1: 2fhq B:4-137 [133498]
   automatically matched to 2FHQ A:3-137

Details for d2fhqb1

PDB Entry: 2fhq, 1.87 Å

PDB Description: Crystal Structure of General Stress Protein from Bacteroides thetaiotaomicron

PDB Compounds: (B:) putative general stress protein

SCOP Domain Sequences for d2fhqb1:

Sequence; same for both SEQRES and ATOM records:

>d2fhqb1 b.45.1.1 (B:4-137) Putative general stress protein BT1439 {Bacteroides thetaiotaomicron [TaxId: 818]}
ktmkekavellqkcevvtlasvnkegyprpvpmskiaaegistiwmstgadslktidfls
npkaglcfqekgdsvalmgevevvtdeklkqelwqdwfiehfpggptdpgyvllkftanh
atywiegtfihkkl

Timeline for d2fhqb1:

• d2fhqb1 is new in SCOP 1.73
  
• d2fhqb1 appears in SCOP 1.75
  
• d2fhqb1 appears in the current release, SCOPe 2.08, called d2fhqb_