Lineage for d2fhqa1 (2fhq A:3-137)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669990Fold b.45: Split barrel-like [50474] (2 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 669991Superfamily b.45.1: FMN-binding split barrel [50475] (3 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 669992Family b.45.1.1: PNP-oxidase like [50476] (16 proteins)
  6. 670063Protein Putative general stress protein BT1439 [141358] (1 species)
  7. 670064Species Bacteroides thetaiotaomicron [TaxId:818] [141359] (1 PDB entry)
  8. 670065Domain d2fhqa1: 2fhq A:3-137 [133497]

Details for d2fhqa1

PDB Entry: 2fhq (more details), 1.87 Å

PDB Description: Crystal Structure of General Stress Protein from Bacteroides thetaiotaomicron
PDB Compounds: (A:) putative general stress protein

SCOP Domain Sequences for d2fhqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhqa1 b.45.1.1 (A:3-137) Putative general stress protein BT1439 {Bacteroides thetaiotaomicron [TaxId: 818]}
tktmkekavellqkcevvtlasvnkegyprpvpmskiaaegistiwmstgadslktidfl
snpkaglcfqekgdsvalmgevevvtdeklkqelwqdwfiehfpggptdpgyvllkftan
hatywiegtfihkkl

SCOP Domain Coordinates for d2fhqa1:

Click to download the PDB-style file with coordinates for d2fhqa1.
(The format of our PDB-style files is described here.)

Timeline for d2fhqa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fhqb1