![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.45: Split barrel-like [50474] (2 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (3 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.1: PNP-oxidase like [50476] (16 proteins) |
![]() | Protein Putative general stress protein BT1439 [141358] (1 species) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [141359] (1 PDB entry) |
![]() | Domain d2fhqa1: 2fhq A:3-137 [133497] |
PDB Entry: 2fhq (more details), 1.87 Å
SCOP Domain Sequences for d2fhqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fhqa1 b.45.1.1 (A:3-137) Putative general stress protein BT1439 {Bacteroides thetaiotaomicron [TaxId: 818]} tktmkekavellqkcevvtlasvnkegyprpvpmskiaaegistiwmstgadslktidfl snpkaglcfqekgdsvalmgevevvtdeklkqelwqdwfiehfpggptdpgyvllkftan hatywiegtfihkkl
Timeline for d2fhqa1: