SCOPe 2.08: Domain d2fhqa1: 2fhq A:3-137

Lineage for d2fhqa1 (2fhq A:3-137)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)

6. Protein Putative general stress protein BT1439 [141358] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [141359] (1 PDB entry)
   Uniprot Q8A7U5 3-137

8. Domain d2fhqa1: 2fhq A:3-137 [133497]
   Other proteins in same PDB: d2fhqb_

Details for d2fhqa1

PDB Entry: 2fhq, 1.87 Å

PDB Description: Crystal Structure of General Stress Protein from Bacteroides thetaiotaomicron

PDB Compounds: (A:) putative general stress protein

SCOPe Domain Sequences for d2fhqa1:

Sequence; same for both SEQRES and ATOM records:

>d2fhqa1 b.45.1.1 (A:3-137) Putative general stress protein BT1439 {Bacteroides thetaiotaomicron [TaxId: 818]}
tktmkekavellqkcevvtlasvnkegyprpvpmskiaaegistiwmstgadslktidfl
snpkaglcfqekgdsvalmgevevvtdeklkqelwqdwfiehfpggptdpgyvllkftan
hatywiegtfihkkl

Timeline for d2fhqa1:

• d2fhqa1 first appeared in SCOP 1.73
  
• d2fhqa1 appears in SCOPe 2.07