Lineage for d2fhpb2 (2fhp B:1-183)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2501814Family c.66.1.46: YhhF-like [142611] (6 proteins)
    Pfam PF03602
  6. 2501837Protein automated matches [190639] (1 species)
    not a true protein
  7. 2501838Species Enterococcus faecalis [TaxId:226185] [187705] (1 PDB entry)
  8. 2501839Domain d2fhpb2: 2fhp B:1-183 [133496]
    Other proteins in same PDB: d2fhpa1, d2fhpa2, d2fhpb3
    automated match to d2fhpa1

Details for d2fhpb2

PDB Entry: 2fhp (more details), 1.6 Å

PDB Description: Crystal Structure of Putative Methylase from Enterococcus faecalis
PDB Compounds: (B:) methylase, putative

SCOPe Domain Sequences for d2fhpb2:

Sequence, based on SEQRES records: (download)

>d2fhpb2 c.66.1.46 (B:1-183) automated matches {Enterococcus faecalis [TaxId: 226185]}
mrvisgeyggrrlkaldgdntrpttdkvkesifnmigpyfdggmaldlysgsgglaieav
srgmdksicieknfaalkvikeniaitkepekfevrkmdanraleqfyeeklqfdlvlld
ppyakqeivsqlekmlerqlltneavivcetdktvklpetigtlkktretvygitqvtiy
rqe

Sequence, based on observed residues (ATOM records): (download)

>d2fhpb2 c.66.1.46 (B:1-183) automated matches {Enterococcus faecalis [TaxId: 226185]}
mrvisgeyggrrlkaldgtdkvkesifnmigpyfdggmaldlysgsgglaieavsrgmdk
sicieknfaalkvikeniaitkepekfevrkmdanraleqfyeeklqfdlvlldppyakq
eivsqlekmlerqlltneavivcetdktvklpetigtlkktretvygitqvtiyrqe

SCOPe Domain Coordinates for d2fhpb2:

Click to download the PDB-style file with coordinates for d2fhpb2.
(The format of our PDB-style files is described here.)

Timeline for d2fhpb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fhpb3