Lineage for d2fhpb1 (2fhp B:1-182)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704539Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 704540Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) (S)
  5. 705207Family c.66.1.46: YhhF-like [142611] (5 proteins)
    Pfam PF03602
  6. 705219Protein Putative methylase EF2452 [142612] (1 species)
  7. 705220Species Enterococcus faecalis [TaxId:1351] [142613] (1 PDB entry)
  8. 705222Domain d2fhpb1: 2fhp B:1-182 [133496]
    automatically matched to 2FHP A:1-182

Details for d2fhpb1

PDB Entry: 2fhp (more details), 1.6 Å

PDB Description: Crystal Structure of Putative Methylase from Enterococcus faecalis
PDB Compounds: (B:) methylase, putative

SCOP Domain Sequences for d2fhpb1:

Sequence, based on SEQRES records: (download)

>d2fhpb1 c.66.1.46 (B:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]}
mrvisgeyggrrlkaldgdntrpttdkvkesifnmigpyfdggmaldlysgsgglaieav
srgmdksicieknfaalkvikeniaitkepekfevrkmdanraleqfyeeklqfdlvlld
ppyakqeivsqlekmlerqlltneavivcetdktvklpetigtlkktretvygitqvtiy
rq

Sequence, based on observed residues (ATOM records): (download)

>d2fhpb1 c.66.1.46 (B:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]}
mrvisgeyggrrlkaldgtdkvkesifnmigpyfdggmaldlysgsgglaieavsrgmdk
sicieknfaalkvikeniaitkepekfevrkmdanraleqfyeeklqfdlvlldppyakq
eivsqlekmlerqlltneavivcetdktvklpetigtlkktretvygitqvtiyrq

SCOP Domain Coordinates for d2fhpb1:

Click to download the PDB-style file with coordinates for d2fhpb1.
(The format of our PDB-style files is described here.)

Timeline for d2fhpb1: