SCOPe 2.02: Domain d2fhpa1: 2fhp A:1-182

Lineage for d2fhpa1 (2fhp A:1-182)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.46: YhhF-like [142611] (6 proteins)
   Pfam PF03602

6. Protein Putative methylase EF2452 [142612] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [142613] (1 PDB entry)
   Uniprot Q831P8 1-182

8. Domain d2fhpa1: 2fhp A:1-182 [133495]
   Other proteins in same PDB: d2fhpb_

Details for d2fhpa1

PDB Entry: 2fhp, 1.6 Å

PDB Description: Crystal Structure of Putative Methylase from Enterococcus faecalis

PDB Compounds: (A:) methylase, putative

SCOPe Domain Sequences for d2fhpa1:

Sequence; same for both SEQRES and ATOM records:

>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]}
mrvisgeyggrrlkaldgdntrpttdkvkesifnmigpyfdggmaldlysgsgglaieav
srgmdksicieknfaalkvikeniaitkepekfevrkmdanraleqfyeeklqfdlvlld
ppyakqeivsqlekmlerqlltneavivcetdktvklpetigtlkktretvygitqvtiy
rq

Timeline for d2fhpa1:

• d2fhpa1 first appeared in SCOP 1.73
  
• d2fhpa1 appears in SCOPe 2.01
  
• d2fhpa1 appears in SCOPe 2.03
  
• d2fhpa1 appears in the current release, SCOPe 2.08