SCOP 1.73: Domain d2fhkc1: 2fhk C:1-148

Lineage for d2fhkc1 (2fhk C:1-148)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (1 family)
   duplication: contains two subdomains of this fold

5. Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein)

6. Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species)

7. Species Archaeon Methanopyrus kandleri [TaxId:2320] [55115] (3 PDB entries)

8. Domain d2fhkc1: 2fhk C:1-148 [133491]
   automatically matched to d1ftra1
   complexed with k, mfn

Details for d2fhkc1

PDB Entry: 2fhk, 2 Å

PDB Description: Crystal structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes

PDB Compounds: (C:) Formylmethanofuran--tetrahydromethanopterin formyltransferase

SCOP Domain Sequences for d2fhkc1:

Sequence; same for both SEQRES and ATOM records:

>d2fhkc1 d.58.33.1 (C:1-148) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Archaeon Methanopyrus kandleri [TaxId: 2320]}
meingveiedtfaeafeakmarvlitaashkwamiavkeatgfgtsvimcpaeagidcgy
vppeetpdgrpgvtimighndedelkeqlldrigqcvmtaptasafdampeaekededrv
gyklsffgdgyqeedeldgrkvwkipvv

Timeline for d2fhkc1:

• d2fhkc1 is new in SCOP 1.73
  
• d2fhkc1 appears in SCOP 1.75
  
• d2fhkc1 appears in the current release, SCOPe 2.08