Lineage for d2fhkc1 (2fhk C:1-148)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (2 families) (S)
    duplication: contains two subdomains of this fold
  5. Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein)
  6. Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species)
  7. Species Methanopyrus kandleri [TaxId:2320] [55115] (3 PDB entries)
  8. Domain d2fhkc1: 2fhk C:1-148 [133491]
    automated match to d1ftra1
    complexed with k, mfn

Details for d2fhkc1

PDB Entry: 2fhk (more details), 2 Å

PDB Description: Crystal structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes
PDB Compounds: (C:) Formylmethanofuran--tetrahydromethanopterin formyltransferase

SCOPe Domain Sequences for d2fhkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhkc1 d.58.33.1 (C:1-148) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Methanopyrus kandleri [TaxId: 2320]}
meingveiedtfaeafeakmarvlitaashkwamiavkeatgfgtsvimcpaeagidcgy
vppeetpdgrpgvtimighndedelkeqlldrigqcvmtaptasafdampeaekededrv
gyklsffgdgyqeedeldgrkvwkipvv

SCOPe Domain Coordinates for d2fhkc1 are not available.

Timeline for d2fhkc1:

Domains from same chain:
(mouse over for more information)
d2fhkc2
Domains from other chains:
(mouse over for more information)
d2fhka1, d2fhka2, d2fhkb1, d2fhkb2, d2fhkd1, d2fhkd2