Lineage for d2fhkc1 (2fhk C:1-148)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955351Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (2 families) (S)
    duplication: contains two subdomains of this fold
  5. 2955352Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein)
  6. 2955353Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species)
  7. 2955371Species Methanopyrus kandleri [TaxId:2320] [55115] (3 PDB entries)
  8. 2955384Domain d2fhkc1: 2fhk C:1-148 [133491]
    automated match to d1ftra1
    complexed with k, mfn

Details for d2fhkc1

PDB Entry: 2fhk (more details), 2 Å

PDB Description: Crystal structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes
PDB Compounds: (C:) Formylmethanofuran--tetrahydromethanopterin formyltransferase

SCOPe Domain Sequences for d2fhkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhkc1 d.58.33.1 (C:1-148) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Methanopyrus kandleri [TaxId: 2320]}
meingveiedtfaeafeakmarvlitaashkwamiavkeatgfgtsvimcpaeagidcgy
vppeetpdgrpgvtimighndedelkeqlldrigqcvmtaptasafdampeaekededrv
gyklsffgdgyqeedeldgrkvwkipvv

SCOPe Domain Coordinates for d2fhkc1:

Click to download the PDB-style file with coordinates for d2fhkc1.
(The format of our PDB-style files is described here.)

Timeline for d2fhkc1: